The domain within your query sequence starts at position 2 and ends at position 226; the E-value for the BASP1 domain shown below is 5.2e-73.

GGKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTPKESEPQAAADATEVKESTEEKPKD
AADGEAKAEEKEADKAAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEA
PKAGEASAESTGAADGAAPEEGEAKKTEAPAAAGPEAKSDAAPAASDSKPSSAEPAPSSK
ETPAASEAPSSAAKAPAPAAPAAAEPQAEAPAAAASSEQSVAVKE

BASP1

BASP1
PFAM accession number:PF05466
Interpro abstract (IPR008408): This family consists of several brain acid soluble protein 1 (BASP1) or neuronal axonal membrane protein NAP-22. The BASP1 is a neuron enriched Ca2+-dependent calmodulin-binding protein of unknown function [(PUBMED:10965107),(PUBMED:9310187)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BASP1