The domain within your query sequence starts at position 1 and ends at position 167; the E-value for the BAT2_N domain shown below is 7e-73.

MSEKSGQSTKAKDGKKYATLSLFNTYKGKSLETQKTTVAARHGLQSLGKVGISRRMPPPA
NLPSLKAENKGNDPNVNIVPKDGTGWASKQEQHEEEKAPEVSPAQPKPGVAAPPEVAPAP
KSWASNKQGGQGDGIQVNSQFQQEFPSLQAAGDQEKKEKEANDENYG

BAT2_N

BAT2_N
PFAM accession number:PF07001
Interpro abstract (IPR009738):

This entry represents the N terminus (approximately 200 residues) of the proline-rich protein BAT2 (also known as PRRC2A). BAT2 is similar to other proteins with large proline-rich domains, such as some nuclear proteins, collagens, elastin, and synapsin [(PUBMED:2156268)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BAT2_N