The domain within your query sequence starts at position 521 and ends at position 796; the E-value for the BCAS3 domain shown below is 1.3e-28.

PSLMVVTPLAQIKQPMTLGTITKRTGPYLFGAGCFSIKAPCKVKSPPQISPSKSMGGEFC
VAAVFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCYGTLVEHMIEPRPISTAPKISD
DTPLEIMTSPRASWTLVRTPQWNELQPPFNANHPLLLAAEAVQYYQLLLAGSLPPGSPGP
ITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFHFKTIQTSGQTTVIST
SSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVR

BCAS3

BCAS3
PFAM accession number:PF12490
Interpro abstract (IPR022175):

This domain family is found in eukaryotes, and is typically between 229 and 245 amino acids in length. The proteins in this family have been shown to be proto-oncogenes implicated in the development of breast cancer.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCAS3