The domain within your query sequence starts at position 58 and ends at position 258; the E-value for the BCIP domain shown below is 2.1e-56.
EVNIEFEAYSISDNDYGGIKKLLQQLFLKAPVNTAELTNLLMQQNHIGSVIKQTDVSEDS DDEVDEDEIFGFISLLNLTERKGTQCAEQIKELVLSFCEKTCEQSMVEQLDKLLNDTSKP VGLLLSERFINVPPQIALPMHQQLQKELSEARRTNKPCGKCCFYLLISKTFMEAGKSSSR KRQDSLQQGALMFANAEEEFF
BCIP |
---|
PFAM accession number: | PF13862 |
---|---|
Interpro abstract (IPR025602): | This family of proteins includes BRCA2 and CDKN1A-interacting protein (BCCIP) and Bcp1. In fungi, Bcp1 is involved in nuclear export, actin cytoskeleton organisation and vesicular transport [ (PUBMED:12912920) ]. Its homologue in human and mouse, BCCIP, may promote cell cycle arrest by enhancing the inhibition of CDK2 activity by CDKN1A/p21 and may be required for repair of DNA damage by homologous recombination in conjunction with BRCA2 [ (PUBMED:14726710) (PUBMED:10878006) (PUBMED:15713648) (PUBMED:17947333) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCIP