The domain within your query sequence starts at position 350 and ends at position 388; the E-value for the BCL9 domain shown below is 5.2e-22.
GLSQEQLEHRERSLQTLRDIQRMLFPDEKEFTAGQTGGP
BCL9 |
---|
PFAM accession number: | PF11502 |
---|---|
Interpro abstract (IPR024670): | The Wnt pathway plays a role in embryonic development, stem cell growth and tumorigenesis. B-cell lymphoma 9 (BCL9) associates with beta-catenin and Tcf in the nucleus when the Wnt pathway is stimulated leading to the transactivation of Wnt target genes [ (PUBMED:17052462) ]. This entry represents a beta-catenin binding domain found in BCL9 and BCL9 homologues. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCL9