The domain within your query sequence starts at position 350 and ends at position 388; the E-value for the BCL9 domain shown below is 5.2e-22.

GLSQEQLEHRERSLQTLRDIQRMLFPDEKEFTAGQTGGP

BCL9

BCL9
PFAM accession number:PF11502
Interpro abstract (IPR024670):

The Wnt pathway plays a role in embryonic development, stem cell growth and tumorigenesis. B-cell lymphoma 9 (BCL9) associates with beta-catenin and Tcf in the nucleus when the Wnt pathway is stimulated leading to the transactivation of Wnt target genes [ (PUBMED:17052462) ].

This entry represents a beta-catenin binding domain found in BCL9 and BCL9 homologues.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCL9