The domain within your query sequence starts at position 19 and ends at position 206; the E-value for the BCLP domain shown below is 1.8e-74.

MRVGLALILVGHVNLLVGAVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLV
ALLASRNLLRPRLHWALLTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMD
PSIPLDQGPGHTDCSFDPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCR
KEGLQEQL

BCLP

BCLP
PFAM accession number:PF12304
Interpro abstract (IPR020977):

This entry represents eukaryotic proteins that are typically between 216 to 240 amino acids in length which have two conserved sequence motifs: VLR and TRIY. Beta-casein-like protein is associated with cell morphology and a regulation of growth pattern of tumours. It is found in adenocarcinomas of uterine cervical tissues[(PUBMED:11394883)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCLP