The domain within your query sequence starts at position 5 and ends at position 40; the E-value for the BCMA-Tall_bind domain shown below is 4.2e-23.
CFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSV
BCMA-Tall_bind |
---|
PFAM accession number: | PF09257 |
---|---|
Interpro abstract (IPR015337): | Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [ (PUBMED:8095800) (PUBMED:1377364) (PUBMED:15335677) ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [ (PUBMED:2989794) (PUBMED:3349526) ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine [ (PUBMED:2268312) ]. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers [ (PUBMED:2777790) ]. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide [ (PUBMED:2777790) ]. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors. Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 [ (PUBMED:12721620) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCMA-Tall_bind