The domain within your query sequence starts at position 376 and ends at position 416; the E-value for the BDHCT domain shown below is 5.5e-27.

QLIHVMEHICKLVDTVPTDELEALNCGTELLQQRNIRRKLL

BDHCT

BDHCT
PFAM accession number:PF08072
Interpro abstract (IPR012532):

This is a C-terminal domain in Bloom's syndrome DEAD helicase subfamily [(PUBMED:15112237)]. The helicase articipates in DNA replication and repair, exhibiting a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction.

GO process:DNA replication (GO:0006260)
GO component:nucleus (GO:0005634)
GO function:ATP binding (GO:0005524), hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BDHCT