The domain within your query sequence starts at position 433 and ends at position 658; the E-value for the BDHCT_assoc domain shown below is 8.8e-108.

GSLWRHRPDSLDNTVQGDSCPVGHPNKELNSPYLLSHSPSTEECLPTTTPGKTGFSATPK
NLFERPLLNSHLQKSFVSSNWAETPRMENRNESTDFPGSVLTSTTVKAQSKQAASGWNVE
RHGQASYDIDNFNIDDFDDDDDDDDWENIMHNFPASKSSTATYPPIKEGGPVKSLSERIS
SAKAKFLPVVSTAQNTNLSESIQNCSDKLAQNLSSKNPKHEHFQSL

BDHCT_assoc

BDHCT_assoc
PFAM accession number:PF16204
Interpro abstract (IPR032439):

This domain is found on Bloom syndrome protein (BLM) helicases in higher eukaryotes [(PUBMED:9388193)]. It lies between the BDHCT (IPR012532), and DEAD-box domains (IPR011545).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BDHCT_assoc