The domain within your query sequence starts at position 330 and ends at position 828; the E-value for the BLM10_mid domain shown below is 8.8e-119.

LAGLFNSITSFYHPSNNGRWLNKLMKLLQRLPNSVVRRLHRERFKKPSWLTPVPESHKLT
DEDVTDFVQCIIQPVLLAMFSKTGSLEAAQALQNLALMRPELVIPPVLERTYPALETLTE
PHQLTATLNCVIGVARSLVSGSKWFPEGPTHMLPLLMRALPGVDPNDFSKCMITFQFIGT
FSTLVPLVDCSSVLQERNDLTEIEKELCSATAEFEDFVLQFMDRCFGLIESSTLEQTREE
TETEKMTHLESLVELGLSSTFSTILTQCSKDIFMVALQKVFNFSVSHIFETRVAGRMVAD
MCRAAVKCCPEESLKLFVPHCYGVITQLTMNDDVLNEEELDKELLWNLQLLSEITRVDGK
KLLLYREQLVKILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFNKPPSE
YFPVKDWGKPGDLWNLGIQWHVPSSEEVSFAFYLLDSFLQPELIKLQCCGDGELEMSRDD
ILQSLTIVHSCLIGSGNLL

BLM10_mid

BLM10_mid
PFAM accession number:PF16507
Interpro abstract (IPR032430):

This entry represents the mid region of the yeast Blm10 or PA200 (human homologue), a proteasome activator that binds the core proteasome and stimulates proteasome-mediated protein degradation by inducing gate opening. It is the middle ordered region of the three in Blm10 [(PUBMED:20227375)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BLM10_mid