The domain within your query sequence starts at position 4 and ends at position 375; the E-value for the BLM_N domain shown below is 1.1e-161.

MAAVPLNNLQEQLQRHSARKLNNQPSLSKPKSLGFTFKKKTSEGDVSVTSVSVVKTPALS
DKDVNVSEAFSFTESPLHKPKQQAKIEGFFKHFPGRQQSKGTCSEPSLPATVQTAQDTLC
TTPKTPTAKKLPVAVFKKLEFSSSADSLSDWADMDDFDMSASDAFASLAKNPATRVSTAQ
KMKKTKRNFFKPPPRKANAVKTDLTPPSPECLQVDLTKESEEEEEEEEEAEGADCLSRDV
ICIDNDSASEELTEKDTQESQSLKAHLGAERGDSEKKSHEDEAVFHSVQNTEYFEHNDND
YDIDFVPPSPEEIISTASSSLKCSSMLKDLDDSDKEKGILSTSEELLSKPEEMTTHKSDA
GTSKDCDAQQIR

BLM_N

BLM_N
PFAM accession number:PF16202
Interpro abstract (IPR032437):

This is the very N-terminal region of chordate Bloom syndrome (BLM) proteins. BLM participates in DNA replication and repair [(PUBMED:9388193), (PUBMED:12019152), (PUBMED:21325134), (PUBMED:23509288)]. The function of this domain is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BLM_N