The domain within your query sequence starts at position 84 and ends at position 270; the E-value for the BMF domain shown below is 1.9e-69.
PGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCG PGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLG EQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQVFLFLQNLALNRQE NREGVGP
BMF |
---|
PFAM accession number: | PF15185 |
---|---|
Interpro abstract (IPR028192): | Bcl-2-modifying factor (BMF) is thought to play a role in inducing apoptosis. It is thought to bind to Bcl-2 proteins [ (PUBMED:11546872) ]. This family of proteins is found in eukaryotes. Proteins in this family are typically between 75 and 190 amino acids in length. There are two conserved sequence motifs: GNA and DQF. |
GO process: | apoptotic process (GO:0006915) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BMF