The domain within your query sequence starts at position 873 and ends at position 1138; the E-value for the BMP2K_C domain shown below is 7.9e-94.

EDFDVFTKAPFNKKVSVQDWPAVGPDARPLPARPRSVDIFGSTPFQPFSVSASKSESKED
VFGLVPFEEITGSQQQQKVKQRSLQKLSSRQRRTKQDVSKSNGKRHHGTPTSAKKTLKPP
YRTPERARRHKKVGRRDSQSSNEFLTISDSKENISVALTDGKDRASVLPSDESLLDPFGA
KPFHPPDLWHQPHQGLSDICVDHTTILPGRPRQNSVHGSFHSAETLRMDDFGAVPFTELV
VQSVTPQQSQPVELDPFGAAPFPSKQ

BMP2K_C

BMP2K_C
PFAM accession number:PF15282
Interpro abstract (IPR028182):

This domain is found at the C terminus of BMP-2-inducible protein kinase (BMP2K) and related proteins. BMP2K may be involved in osteoblast differentiation [(PUBMED:11500515), (PUBMED:11693963)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BMP2K_C