The domain within your query sequence starts at position 48 and ends at position 178; the E-value for the BNIP2 domain shown below is 4.5e-38.
RPMRKRLSAPEWQLSLTEGTGENGASPTRSASSSSAGSLDLEVDELETPSDSEQLDSGHE FEWEDDLPRAEGLGASEAAERLGRGCVCDVAGEDGHRWRVFRTGQREQRVDMTIIEPYKK VLSHGGYHGDG
BNIP2 |
---|
PFAM accession number: | PF12496 |
---|---|
Interpro abstract (IPR022181): | This domain family is found in eukaryotes, and is typically between 119 and 133 amino acids in length. There is a conserved HGGY sequence motif. This family is Bcl2-/adenovirus E1B nineteen kDa-interacting protein 2. It interacts with pro- and anti- apoptotic molecules in the cell. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BNIP2