The domain within your query sequence starts at position 7 and ends at position 207; the E-value for the BORA_N domain shown below is 2.4e-69.

LKMQITPETPGRIPVLNPFESPSDYSNLHEQTLASPSIFKSTKLPTPGKFRWSIDQLAII
NPVEIDPEEIHRQASYLRLSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHDGKQPSELH
PSKCLSSHDDSPDGKKPSLPSQKCNAACQTLLSLPVDFNLEAILGDYFREEDFVAHTPGN
LSSSSLRRKLFLDGNGSICDP

BORA_N

BORA_N
PFAM accession number:PF15280
Interpro abstract (IPR023252):

Aurora-A, a protein kinase required for centrosome maturation, spindle assembly and asymmetric protein localisation during mitosis, is activated by Aurora borealis protein at the onset of the mitotic cycle [(PUBMED:16890155)]. Bora is a nuclear protein in interphase cells, but is excluded from the nucleus and translocates to the cytoplasm in a Cdc2-dependent manner when the cell enters mitosis [(PUBMED:16890155)]. It has been suggested that activation of Cdc2 initiates the release of Bora into the cytoplasm, where it binds and activates Aurora-A [(PUBMED:16890155)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BORA_N