The domain within your query sequence starts at position 115 and ends at position 232; the E-value for the BORG_CEP domain shown below is 2.5e-21.

IIKNAISLPQLNQATYDSLVMGKLSFDSTPASSTDGHSGYGLESGFCTISRLPRVEKHSN
RDRDRDPDHSQDREQSSFPSEPTPNPELRRSDSLLSFRFDLDLGPSLLSELLGVMSLS

BORG_CEP

BORG_CEP
PFAM accession number:PF14957
Interpro abstract (IPR029273):

The Rho-type GTPase Cdc42 regulates cell morphology and signal transduction in eukaryotic cells. The Cdc42 effector (CEP) or binder of Rho GTPase (BORG) proteins are involved in the organisation of the actin cytoskeleton [(PUBMED:11035016)]. They may function as negative regulators of Rho GTPase signaling [(PUBMED:10490598)].

This family consists of Cdc42 effector proteins, including CEP1-5 from humans.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BORG_CEP