The domain within your query sequence starts at position 665 and ends at position 714; the E-value for the BPL_C domain shown below is 4.9e-13.

HGGQQVRLGSTEGPQASIVGLDDSGFLQVHQEDGGVVTVHPDGNSFDMLR

BPL_C

BPL_C
PFAM accession number:PF02237
Interpro abstract (IPR003142):

This C-terminal domain has an SH3-like barrel fold, the function of which is unknown. It is found associated with prokaryotic bifunctional transcriptional repressors [(PUBMED:2642476)] and eukaryotic enzymes involved in biotin utilization [(PUBMED:7842009), (PUBMED:9173880)].

In Escherichia coli the biotin operon repressor (BirA) is a bifunctional protein. BirA acts both as the acetyl-coA carboxylase biotin holoenzyme synthetase (EC 6.3.4.15) and as the biotin operon repressor. DNA sequence analysis of mutations indicates that the helix-turn-helix DNA binding region is located at the N terminus while mutations affecting enzyme function, although mapping over a large region, are found mainly in the central part of the protein's primary sequence [(PUBMED:2642476)].

GO process:cellular protein modification process (GO:0006464)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BPL_C