The domain within your query sequence starts at position 342 and ends at position 503; the E-value for the BRCT_assoc domain shown below is 2.6e-69.
DSLSDREKWTHPQSLCPENSGATTDVPWITLNSSVQKVNEWFSRTGEMLTSDSASARRHE SNAEAAVVLEVSNEVDGGFSSSRKTDLVTPDPHHTLMCKSGRDFSKPVEDNISDKIFGKS YQRKGSRPHLNHVTEIIGTFITEPQITQEQPFTNKLKRKRST
BRCT_assoc |
---|
PFAM accession number: | PF12820 |
---|---|
Interpro abstract (IPR025994): | This serine-rich domain is found on BRCA1 proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BRCT_assoc