The domain within your query sequence starts at position 913 and ends at position 956; the E-value for the BRD4_CDT domain shown below is 3e-26.

LWLLKDRNLAREKEQERRRREAMAGTIDMTLQSDIMTMFENNFD

BRD4_CDT

BRD4_CDT
PFAM accession number:PF17105
Interpro abstract (IPR031354):

This entry represents the short highly conserved C-terminal domain of certain bromodomain proteins, notably Brd4. The Brd4 CTD interacts with the cyclin T1 and Cdk9 subunits of positive transcription elongation factor b (pTEFb) complex. Brd4 displaces negative regulators, the HEXIM1 and 7SKsnRNA complex, from pTEFb, thereby transforming it into an active form that can phosphorylate RNA pol II [(PUBMED:16109376), (PUBMED:21555454)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BRD4_CDT