The domain within your query sequence starts at position 3 and ends at position 269; the E-value for the BRE domain shown below is 9.5e-182.

ACRDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYHQ
FQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPT
YLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGGGCL
IDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDF
CFLVHIDLPLFFPRDQPTLTFQSVYHF

BRE

BRE
PFAM accession number:PF06113
Interpro abstract (IPR010358):

Brain and reproductive organ-expressed (BRE, also known as BRCC45) is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs) [ (PUBMED:14636569) ]. It acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity and modulating the E3 ubiquitin ligase activity of the BRCA1-BARD1 heterodimer [ (PUBMED:21282113) (PUBMED:19261748) ]. It is also part of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates [ (PUBMED:19214193) (PUBMED:24075985) (PUBMED:25283148) (PUBMED:26195665) ]. Within the BRISC complex, it acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity [ (PUBMED:21282113) ].

GO component:BRCA1-A complex (GO:0070531), BRISC complex (GO:0070552)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BRE