SMART: Pfam domain BRF1

The domain within your query sequence starts at position 452 and ends at position 545; the E-value for the BRF1 domain shown below is 3.3e-29.

DDLEIDRYILNESEARVKAELWMRENAEYLREQKEKEARIAKEKELGIYKEHKPKKSCKR
REPILASTAGEAIEKMLEQKKISSKINYSVLRDL

BRF1

PFAM accession number:	PF07741
Interpro abstract (IPR011665):	In budding yeasts, Brf1 forms the TFIIIB complex with TATA-binding protein (TBP) and Bdp1 [ (PUBMED:24336746) ]. The TFIIIB complex can be recruited to the Pol III promoters and form an exceptionally kinetically stable TFIIIB-DNA complex, which then recruits the Pol III enzymatic complex and helps maintain it for multiple transcription cycles in a process called facilitated recycling [ (PUBMED:24277937) ]. This entry represents the TATA binding protein (TBP) binding domain of Brf1 that covers both the Brf homology II and III regions [ (PUBMED:12660736) ].

PFAM accession number:

PF07741

Interpro abstract (IPR011665):

In budding yeasts, Brf1 forms the TFIIIB complex with TATA-binding protein (TBP) and Bdp1 [ (PUBMED:24336746) ]. The TFIIIB complex can be recruited to the Pol III promoters and form an exceptionally kinetically stable TFIIIB-DNA complex, which then recruits the Pol III enzymatic complex and helps maintain it for multiple transcription cycles in a process called facilitated recycling [ (PUBMED:24277937) ].

This entry represents the TATA binding protein (TBP) binding domain of Brf1 that covers both the Brf homology II and III regions [ (PUBMED:12660736) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BRF1