The domain within your query sequence starts at position 12 and ends at position 1293; the E-value for the BROMI domain shown below is < 1e-12.

LQAMLRQLFQSVKEKITGAPSLECAEEILLRLEETDENFHNYEFVKYLRQHICNMLGSMI
EEEMEKCTSDQNQGEDSGYDTVVQHVTKRTQESKEYKEMMHSLKNIMMVVVEAMINKFEE
DETRSEDRQRKMQSGSCCTDNCSDSDSSFNQSYKFCQGKLRLILDQLDPGQPKEVRYEAL
QTLCSAPPSDVLSCENWTTLCEKLTTSLSDPDPMFTDRILKFYAQTFTLSPLHMTKEIYT
SLAKYLEVYFLSRENHLPTLSTGVDITSPNVTRLLKKVRLLNEYQKEAPSFWIRHPEKYM
EEIVESTLSLLSVKHEQSHLVPQKILDPIYFFALVDTKAVWFKKWMHAYYSRTAVLRLLE
KKYKCLITTAVQQCVQYLELCEAMKADEILRHPKHCGTKQKSFYYSGQELQYIYFIHSLC
LLGRLLIYTQGRKLFPIKLKNRKDSVSLTNLLVLFTQLIYYSPSCPKMTSIMCSENYSPA
SMVTDVLRMLCDQKECAVECLYNSTVTEALLLPIHNLTKGTAAAPDCSETALIHIADILA
RIASVEEGLILLLYGENMNSSEEESLTGAHIIAKFSKKLLEEDISIFSGSEMLPVVKGAF
ISVCRQIYGTCEGLQVLLPYGLHESIAKAWKKTSLLSERIPTPVEGSDSVSSVSQVSPNS
VAWEDNLLDDLLNFAATPKGLLLLQRTGAINECVTFMLSQYAKKPQVNRQKKFGYEVLVV
QVASTAAGAVALQNSGFISALITELWSNLECGRDDVRLTHPRATPVDPIDRSCQKSFLAL
VNLLSYPAVYELTANQELPNKAEYSLREVPTCIIDIMDRLIVLNSEAKIRSLLNYEQSHT
FGLRLLSVVCCDLDALLLLEAQYQVSNMLLHAQEENTFEISENHRNFIIDGLSVERNHVL
VRINLIGGPSERILPPRMLEKGDDPYPWPMFSSYPLPHCYQSEGPRSADLKQDNDIGNLL
SCFKMSDKQTEWIENCRRQFCKTMKSKPDAVHGSALGELLEKFVLLLTENPSECYFPSVE
YTATDANVKNESLSSVQQLGMKMTVRYGRFLNLLKDGAENELALVLKHCEKFLKQQQSPV
TSSLLCLQGNYAGHDWFVSSLFMIMLGDKGKTFHFLQHFSRLLTSAFLWVPRLHNSRYLP
VDTLGTGIHPIYFCSAHYIEMLLKAEVPLVFSAFHMSGFAPSQICLQWITQCFWNYLDWI
EICHYIATCVVLGPDYQVYVCIAVLKHLQRDILQHTQTQDLQVFLKEEALHGFRVSNYFE
YMENLEQNYRPVLLRDMRSIRV

BROMI

BROMI
PFAM accession number:PF14961
Interpro abstract (IPR032735):

Broad-minded protein (BROMI) interacts with cell cycle-related kinase (CCRK), together these proteins regulate ciliary membrane and axonemal growth [(PUBMED:20159594)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BROMI