The domain within your query sequence starts at position 104 and ends at position 144; the E-value for the BSD domain shown below is 8.1e-8.
QLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVIS
BSD |
---|
PFAM accession number: | PF03909 |
---|---|
Interpro abstract (IPR005607): | The BSD domain is an about 60-residue long domain named after the BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins in which it is found. Additionally, it is also found in several hypothetical proteins. The BSD domain occurs in one or two copies in a variety of species ranging from primal protozoan to human. It can be found associated with other domains such as the BTB domain or the U-box in multidomain proteins. The function of the BSD domain is unknown [ (PUBMED:11943536) ]. Secondary structure prediction indicates the presence of three predicted alpha helices, which probably form a three-helical bundle in small domains. The third predicted helix contains neighbouring phenylalanine and tryptophan residues - less common amino acids that are invariant in all the BSD domains identified and that are the most striking sequence features of the domain [ (PUBMED:11943536) ]. Some proteins known to contain one or two BSD domains are listed below:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BSD