The domain within your query sequence starts at position 17 and ends at position 321; the E-value for the BSP_II domain shown below is 2.8e-127.

FSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPVQGGSDSSEENGDGDSS
EEEGEEEETSNEEENNEDSEGNEDQEAEAENSTLSTLSGVTASYGAETTPQAQTFELAAL
QLPKKAGDAESRAPKVKESDEEEEEEEEEEENENEEAEVDENELAVNGTSTNSTEVDGGN
GSSGGDNGEEAEAEEASVTEAGAEGTTGGRELTSVGTQTAVLLNGFQQTTPPPEAYGTTS
PPIRKSSTVEYGGEYEQTGNEYNNEYEVYDNENGEPRGDTYRAYEDEYSYYKGHGYEGYE
GQNYY

BSP_II

BSP_II
PFAM accession number:PF05432
Interpro abstract (IPR008412):

The major non-collagenous matrix proteins (chondroitin-sulphate glycoproteins decorin and biglycan, sialoproteins osteopontin and bone sialoprotein, osteocalcin and osteonectin) have important roles in formation and organisation of the collagen matrix and nucleation and growth of hydroxyapatite crystals.

Bone sialoprotein (BSP) is a major structural protein of the bone matrix that is specifically expressed by fully differentiated osteoblasts [(PUBMED:8061918)], [(PUBMED:10759428)] and is highly specific for mineralising tissues. The expression of bone sialoprotein (BSP) is normally restricted to mineralised connective tissues of bones and teeth; it is thought to be responsible for nucleation of hydroxyapatite crystals. BSP also displays a high affinity for calcium ions. The mature protein has a molecular weight of around 33 kDa and consists predominantly of Glu and Gly residues. It is subject to extensive posttranslational modification, and is predominantly phosphorylated at Ser residues. Posttranslational modifications can also cause BSP to act as an inhibitor of hydroxyapatite crystal formation. Ectopic expression of BSP occurs in various lesions, including oral and extraoral carcinomas, in which it has been associated with the formation of microcrystalline deposits and the metastasis of cancer cells to bone [(PUBMED:10785518)].

This entry represents the bone sialoprotein II group of proteins.

GO process:cell adhesion (GO:0007155), ossification (GO:0001503)
GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BSP_II