The domain within your query sequence starts at position 19 and ends at position 89; the E-value for the BTB domain shown below is 1.7e-13.

RAMFTGGMREANQAVIQLQGVSARGLRHIIDFAYSAEVTLDLDCVQDVLGAAVFLQMLPV
VELCEDFLKAA

BTB

BTB
PFAM accession number:PF00651
Interpro abstract (IPR000210):

The BTB domain (Broad-Complex, Tramtrack and Bric a brac) is also known as the POZ domain (POxvirus and Zinc finger). It is a homodimerization domain occurring at the N terminus of proteins containing multiple copies of either zinc fingers of the C2H2 type or Kelch repeats [(PUBMED:7938017), (PUBMED:7958847)]. Many BTB proteins are transcriptional regulators that are thought to act through the control of chromatin structure.

The structure of the BTB domain of the promyelocytic leukemia zinc finger (PLZF) protein has been determined by X-ray crystallography and reveals a tightly intertwined dimer with an extensive hydrophobic interface [(PUBMED:9770450)]. A surface-exposed groove lined with conserved amino acids is formed at the dimer interface, suggesting a peptide-binding site.

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BTB