The domain within your query sequence starts at position 15 and ends at position 92; the E-value for the BTB_2 domain shown below is 1.3e-9.

FHFNVGGWHFSVPRSKLAQFPDSLLWKEASALTSSENQRLFIDRDGSTFRHVHYYLYTSK
LSFSSCAELNLLYEQALG

BTB_2

BTB_2
PFAM accession number:PF02214
Interpro abstract (IPR003131):

This domain can be found at the N terminus of voltage-gated potassium channel proteins, where represents a cytoplasmic tetramerisation domain (T1) involved in assembly of alpha-subunits into functional tetrameric channels [(PUBMED:9886290)]. This domain can also be found in proteins that are not potassium channels, like KCTD1 (potassium channel tetramerisation domain-containing protein 1). KCTD1 is though to be a nuclear protein that functions as a transcriptional repressor. In KCTD1, the T1-type BTB domain mediates homomeric protein-protein interactions [(PUBMED:18358072), (PUBMED:19115315)].

GO process:protein homooligomerization (GO:0051260)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BTB_2