The domain within your query sequence starts at position 151 and ends at position 468; the E-value for the Bac_surface_Ag domain shown below is 1.8e-68.

NLLGRAEKVTFQFSYGTKETSYGLSFFKPQPGNFERNFSVNLYKVTGQFPWSSLRETDRG
VSAEYSFPLWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSS
ILPRRGALFKVNQELAGYTGGDVSFIKEDFELQLNKPLALDSVFSTSLWGGMLVPIGDKP
SSIADRFYLGGPTSVRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGEL
FRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGVVLRLGNIARLELNYCIPMGV
QGGDRICDGVQFGAGIRF

Bac_surface_Ag

Bac_surface_Ag
PFAM accession number:PF01103
Interpro abstract (IPR000184): The protein sequences of d15 from various strains of Haemophilus influenzae are highly conserved, with only a small variable region identified near the carboxyl terminus of the protein [(PUBMED:7737523)]. D15 is a highly conserved antigen that is protective in animal models and it may be a useful component of a universal subunit vaccine against Haemophilus infection and disease [(PUBMED:9284140)]. Membrane proteins from other bacteria have been shown to elicit protective immunity. Oma87 is a protective outer membrane antigen of Pasteurella multocida [(PUBMED:8757848)].
GO component:outer membrane (GO:0019867)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bac_surface_Ag