The domain within your query sequence starts at position 93 and ends at position 233; the E-value for the Band_3_cyto domain shown below is 1.4e-36.
KVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIADHQIETGLL KPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASSPAMTHRNLTSSSLNDISDKP EKDQLKNKFMKKLPRDAEASN
Band_3_cyto |
![]() |
---|
PFAM accession number: | PF07565 |
---|---|
Interpro abstract (IPR013769): | This entry contains the cytoplasmic domain of the Band 3 anion exchange proteins that exchange Cl-/HCO3-. Band 3 constitutes the most abundant polypeptide in the red blood cell membrane, comprising 25% of the total membrane protein. The cytoplasmic domain of band 3 functions primarily as an anchoring site for other membrane-associated proteins. Included among the protein ligands of cdb3 are ankyrin, protein 4.2, protein 4.1, glyceraldehyde-3-phosphate dehydrogenase (GAPDH), phosphofructokinase, aldolase, hemoglobin, hemichromes, and the protein tyrosine kinase (p72syk) [ (PUBMED:11049968) ]. |
GO process: | anion transport (GO:0006820) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | anion transmembrane transporter activity (GO:0008509) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Band_3_cyto