The domain within your query sequence starts at position 218 and ends at position 280; the E-value for the Band_7_C domain shown below is 3.6e-28.
RILAGALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTVLLPSNPSDVTSMVAQAMGVYGA LTK
Band_7_C |
 |
|---|
| PFAM accession number: | PF16200 |
|---|---|
| Interpro abstract (IPR032435): | This domain is found on a subset of proteins as a C-terminal extension of the Band 7 domain ( IPR001107 ). It is found in proteins from bacteria to fungi, plants and mammals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Band_7_C