The domain within your query sequence starts at position 218 and ends at position 280; the E-value for the Band_7_C domain shown below is 3.6e-28.

RILAGALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTVLLPSNPSDVTSMVAQAMGVYGA
LTK

Band_7_C

Band_7_C
PFAM accession number:PF16200
Interpro abstract (IPR032435):

This domain is found on a subset of proteins as a C-terminal extension of the Band 7 domain (IPR001107). It is found in proteins from bacteria to fungi, plants and mammals.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Band_7_C