The domain within your query sequence starts at position 1 and ends at position 152; the E-value for the Bax1-I domain shown below is 3.3e-15.

XVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSIVLIFKYDLEARWGSWRGSFPTCLS
SWSPRVSWVSKACFGYALRGSLMPYCAILQIYWLHMVYAALGAICFTLFLAYDTQLVLGN
RKHTISPEDYITGALQIYTDIVYIFTFVLQLV

Bax1-I

Bax1-I
PFAM accession number:PF01027
Interpro abstract (IPR006214):

Bax inhibitor-1 (BI-1) [(PUBMED:8530040)] is a suppressor of apoptosis that interacts with BCL2 and BCL-X. Human Bax BI-1 is an evolutionarily conserved integral membrane protein containing multiple membrane-spanning segments predominantly localised to intracellular membranes. It has 6-7 membrane-spanning domains. The C termini of the mammalian BI-1 proteins are comprised of basic amino acids resembling some nuclear targeting sequences, but otherwise the predicted proteins lack motifs that suggest this function. As plant BI-1 appears to localise predominantly to the ER, it was suggested that plant BI-1 could also regulate cell death triggered by ER stress [(PUBMED:19704470)]. BI-1 appears to exert its effect through an interaction with calmodulin [(PUBMED:19742129)].

This entry represents BI-1 and related sequences, including lifeguard proteins, which also act as apoptotic regulators.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bax1-I