The domain within your query sequence starts at position 71 and ends at position 109; the E-value for the Bclx_interact domain shown below is 9.7e-22.

MASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRV

Bclx_interact

Bclx_interact
PFAM accession number:PF08945
Interpro abstract (IPR015040):

This domain is a long alpha helix, required for interaction with Bcl-x. It is found in BAM, Bim and Bcl2-like protein 11 [ (PUBMED:14499110) ]. This domain is also known as the BH3 domain between residues 146 and 161.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bclx_interact