The domain within your query sequence starts at position 71 and ends at position 109; the E-value for the Bclx_interact domain shown below is 9.7e-22.
MASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRV
Bclx_interact |
---|
PFAM accession number: | PF08945 |
---|---|
Interpro abstract (IPR015040): | This domain is a long alpha helix, required for interaction with Bcl-x. It is found in BAM, Bim and Bcl2-like protein 11 [ (PUBMED:14499110) ]. This domain is also known as the BH3 domain between residues 146 and 161. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bclx_interact