The domain within your query sequence starts at position 28 and ends at position 302; the E-value for the BcrAD_BadFG domain shown below is 1.1e-19.
RGGTRSKVLLLSEDGQILAEADGLSTNHWLIGTDQCVERINEMVDRAKQKAGVDPLVPLR SLGLSLSGGEQEDAVRLLIEELRHRFPNLSENYLITTDAAGSIATATPDGGIVLISGTGS NCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGHVKQAMF DYFQVPDRLGILTHLYRDFDKCKFAGFCQKIAEGAHQGDPLSRYIFRKAGEMLGRHVVAV LPEIDPVLFQGELGLPILCVGSVWKSWELLKEGFL
BcrAD_BadFG |
---|
PFAM accession number: | PF01869 |
---|---|
Interpro abstract (IPR002731): | This domain is found in the BadF ( O07462 ) and BadG ( O07463 ) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis. The family also includes an activase subunit from the enzyme 2-hydroxyglutaryl-CoA dehydratase ( P11568 ). The hypothetical protein AQ_278 from Aquifex aeolicus O66634 contains two copies of this region suggesting that the family may structurally dimerise. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BcrAD_BadFG