The domain within your query sequence starts at position 87 and ends at position 440; the E-value for the Beta-lactamase domain shown below is 3e-42.

VDGILRKAMLAPGLAAMSALVIHNDTVLWTGNFGRKNGSDPNSGTPNEYTMYRIASISKI
FPVLMLYRLWEEGIVDSLDDPLERYASTFSINNPLGTAQGPGAQGPTGESEEMGSLPRPS
PVTLRRMASQLSGLPRRLRGTSLLWRGSTQEALSLLKDDVLVADPGTRCHYSTLAFSLLA
HVLAAHRAQGDYERWVSEQVLEPLGMSDTGFALTGTVRARLAAGFYGSGRSAPLYDLGWY
RPSGQMYSTAADLARLAAALLGAGPRRLLRPDSLATLLAPLRACAHGYFASETGTPWEFH
ERRGYRVARKDGDLDGYAASLALVPPLRLGFVLLLAGPRPPTRDLVADALDTLL

Beta-lactamase

Beta-lactamase
PFAM accession number:PF00144
Interpro abstract (IPR001466):

This entry represents the serine beta-lactamase-like superfamily. It is a group of diverse group of sequences that includes D-alanyl-D-alanine carboxypeptidase B, aminopeptidase (DmpB), alkaline D-peptidase, animal D-Ala-D-Ala carboxypeptidase homologues and the class A and C beta-lactamases and eukaryotic beta-lactamase homologues which are variously described as: transesterases, non-ribosomal peptide synthetases and hypothetical proteins. Many are serine peptidases belonging to MEROPS peptidase families S11 (D-Ala-D-Ala carboxypeptidase A family) and S12 (D-Ala-D-Ala carboxypeptidase B family, clan SE). The beta-lactamases are classified as both S11 and S12 non-peptidase homologues; these either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.

Beta-lactamase catalyses the opening and hydrolysis of the beta-lactam ring of beta-lactam antibiotics such as penicillins and cephalosporins [ (PUBMED:1856867) ]. There are four groups, classed A, B, C and D according to sequence, substrate specificity, and kinetic behaviour: class A (penicillinase-type) is the most common [ (PUBMED:1856867) ]. The genes for class A beta-lactamases are widely distributed in bacteria, frequently located on transmissible plasmids in Gram-negative organisms, although an equivalent chromosomal gene has been found in a few species [ (PUBMED:2788410) ].

Class A, C and D beta-lactamases are serine-utilising hydrolases - class B enzymes utilise a catalytic zinc centre instead. The 3 classes of serine beta-lactamase are evolutionarily related and belong to a superfamily that also includes DD-peptidases and other penicillin-binding proteins [ (PUBMED:3128280) ]. All these proteins contain an S-x-x-K motif, the Ser being the active site residue. Although clearly related, however, the sequences of the 3 classes of serine beta-lactamases vary considerably outside the active site.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Beta-lactamase