The domain within your query sequence starts at position 531 and ends at position 623; the E-value for the BetaGal_dom4_5 domain shown below is 4.3e-10.

ASDEGHLDGRSTSNSSDLILPTFYVGNFSIPSGIPDLPQDTFIQFPGWSKGQVWINGFNL
GRYWPTMGPQKTLFVPRNILTTSAPNNITVLEL

BetaGal_dom4_5

BetaGal_dom4_5
PFAM accession number:PF13364
Interpro abstract (IPR025300):

This domain is found in beta-galactosidase enzymes, mainly from the glycosyl hydrolase 35 family. It has a jelly roll fold [(PUBMED:15491613)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BetaGal_dom4_5