The domain within your query sequence starts at position 83 and ends at position 797; the E-value for the BicD domain shown below is < 1e-12.

GQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERL
TSVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQ
VEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNNLRKELS
HYMSINDSFYTSHLQVSLDGLKFSDDTVTAEPNNDAEALVNGFEHSGLVKSSLDNKTSTP
RKDGLAPPSPSLVSDLLSELHISEIQKLKQQLVQMEREKVGLLATLQDTQKQLEQARGTL
SEQHEKVNRLTENLSALRRLQAGKERQTSLDNEKDRDSHEDGDYYEVDINGPEILACKYH
VAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQALTEKISLLEKASHQDRELLA
HLEKELKKVSDVAGETQGSLNVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREG
QGKAGRTSPEGRGRRSPVLLPKGLLATEVGRADGGTGDNSPSPSSSLPSPLSDPRREPMN
IYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEALMEEILKLKSLLSTK
REQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSL
RAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLEL

BicD

BicD
PFAM accession number:PF09730
Interpro abstract (IPR018477):

BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [(PUBMED:19018277)]. Glycogen synthase kinase-3beta (GSK-3beta) is required for the binding of BICD to dynein but not to dynactin, acting to maintain the anchoring of microtubules to the centromere [(PUBMED:17139249)]. It appears that amino-acid residues 437-617 of BicD and the kinase activity of GSK-3 are necessary for the formation of a complex between BicD and GSK-3beta in intact cells [(PUBMED:17139249)].

GO process:transport (GO:0006810)
GO component:Golgi apparatus (GO:0005794)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BicD