The domain within your query sequence starts at position 9 and ends at position 723; the E-value for the BicD domain shown below is < 1e-12.

GQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERL
TSVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQ
VEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNNLRKELS
HYMSINDSFYTSHLQVSLDGLKFSDDTVTAEPNNDAEALVNGFEHSGLVKSSLDNKTSTP
RKDGLAPPSPSLVSDLLSELHISEIQKLKQQLVQMEREKVGLLATLQDTQKQLEQARGTL
SEQHEKVNRLTENLSALRRLQAGKERQTSLDNEKDRDSHEDGDYYEVDINGPEILACKYH
VAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQALTEKISLLEKASHQDRELLA
HLEKELKKVSDVAGETQGSLNVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREG
QGKAGRTSPEGRGRRSPVLLPKGLLATEVGRADGGTGDNSPSPSSSLPSPLSDPRREPMN
IYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEALMEEILKLKSLLSTK
REQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSL
RAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLEL

BicD

BicD
PFAM accession number:PF09730
Interpro abstract (IPR018477):

Bicaudal-D (BicD) is a family of motor adaptor proteins consist of three coiled-coiled domains. BicD plays an essential for the correct localization of maternal mRNAs in Drosophila's oocyte [(PUBMED:17827179)] and functions as a regulator of the Golgi to ER retrograde transport in mammalian cells [(PUBMED:19018277)]. BicD was suggested to be a linker bridging cargo and dynein and have roles in the regulation of cargo motility [(PUBMED:19754453)]. It also functions as a novel regulator of neurotrophin (NT) signaling [(PUBMED:28215293)].

GO function:dynein complex binding (GO:0070840), cytoskeletal adaptor activity (GO:0008093)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BicD