The domain within your query sequence starts at position 159 and ends at position 265; the E-value for the Bin3 domain shown below is 7.3e-24.

FDMVFCMSVTMWIHLNHGDRGLCEFLAHVSSLCSYLLVEPQPWKCYRAAARRLRKLGLHS
FDHFRSLAIRGDMAKQIVRILTQDHGMELACCFGNTSWDRSLLLFRA

Bin3

Bin3
PFAM accession number:PF06859
Interpro abstract (IPR010675): This entry represents the C-terminal conserved region of the Drosophila probable RNA methyltransferase bin3 [(PUBMED:1071748)]. Proteins containing this domain also include human pre-miRNA 5'-monophosphate methyltransferase BCDIN3D [(PUBMED:23063121)] and 7SK snRNA methylphosphate capping enzyme MEPCE [(PUBMED:17643375)]. This domain contains a conserved HLN motif.
GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bin3