The domain within your query sequence starts at position 59 and ends at position 167; the E-value for the Bin3 domain shown below is 8.3e-47.

YDVVLCFSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYCKRKSLTETIY
KNYFRIQLKPEQFSSYLTSPEVGFSSYELVATPNNTSRGFQRPVYLFHK

Bin3

Bin3
PFAM accession number:PF06859
Interpro abstract (IPR010675):

This entry represents the C-terminal conserved region of the Drosophila probable RNA methyltransferase bin3 [ (PUBMED:1071748) ]. Proteins containing this domain also include human pre-miRNA 5'-monophosphate methyltransferase BCDIN3D [ (PUBMED:23063121) ] and 7SK snRNA methylphosphate capping enzyme MEPCE [ (PUBMED:17643375) ]. This domain contains a conserved HLN motif.

GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bin3