The domain within your query sequence starts at position 885 and ends at position 951; the E-value for the Biotin_lipoyl domain shown below is 9.1e-17.

TVLRSPSAGKLMQYTVEDGDHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGVILEA
GCVVARL

Biotin_lipoyl

Biotin_lipoyl
PFAM accession number:PF00364
Interpro abstract (IPR000089): The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid. Biotin plays a catalytic role in some carboxyl transfer reactions and is covalently attached, via an amide bond, to a lysine residue in enzymes requiring this coenzyme [(PUBMED:1526981)]. E2 acyltransferases have an essential cofactor, lipoic acid, which is covalently bound via an amide linkage to a lysine group [(PUBMED:1825611)]. The lipoic acid cofactor is found in a variety of proteins that include, H-protein of the glycine cleavage system (GCS), mammalian and yeast pyruvate dehydrogenases and fast migrating protein (FMP) (gene acoC) from Ralstonia eutropha (Alcaligenes eutrophus).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Biotin_lipoyl