The domain within your query sequence starts at position 26 and ends at position 94; the E-value for the BolA domain shown below is 7.5e-18.

QVLKEKFPRATAIQVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKGMHG
LRIFTSVPK

BolA

BolA
PFAM accession number:PF01722
Interpro abstract (IPR002634):

This family consist of the morpho-protein BolA from Escherichia coli and its various homologues. In E. coli, over-expression of this protein causes round morphology and may be involved in switching the cell between elongation and septation systems during cell division [(PUBMED:10361282)]. The expression of BolA is growth rate regulated and is induced during the transition into the the stationary phase [(PUBMED:10361282)]. BolA is also induced by stress during early stages of growth [(PUBMED:10361282)] and may have a general role in stress response. It has also been suggested that BolA can induce the transcription of penicillin binding proteins 6 and 5 [(PUBMED:2684651), (PUBMED:10361282)]. IbaG is a BolA homologue involved in acid resistance [(PUBMED:22534295)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BolA