The domain within your query sequence starts at position 1067 and ends at position 1131; the E-value for the Bravo_FIGEY domain shown below is 2.5e-12.

KRNRGGKYSVKEKEDLHPDPEVQSAKDETFGEYRKMVLKQKLLSWSSSRGRTFYSCTKNT
LFDGS

Bravo_FIGEY

Bravo_FIGEY
PFAM accession number:PF13882
Interpro abstract (IPR026966):

This is the very C-terminal region of nervous system cell adhesion molecules neuroglian, neurofascin, neural adhesion molecule L1, NrCAM and NgCAM [(PUBMED:7961622)]. It lies upstream of the IG and Fn3 domains and has the highly conserved motif FIGEY. The function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bravo_FIGEY