The domain within your query sequence starts at position 582 and ends at position 721; the E-value for the C2-C2_1 domain shown below is 1.9e-49.

MSLLHPSENLFELHVHQAFLTPAALTQAGDTQPTTFCTYSFYDFETHCTPLSTGPQPLYD
FTSQYVVQADYLLLHYLQGTSVRLDLHQAMASEYHVLATGWISLDKVLGTVERVHGLATL
AGAGGEDLGVLEYWMRLCLP

C2-C2_1

C2-C2_1
PFAM accession number:PF11618
Interpro abstract (IPR021656):

This domain is the first, more N-terminal, C2 domain on X-linked retinitis pigmentosa GTPase regulator-interacting proteins, or RPGR-interacting proteins [(PUBMED:17558409)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry C2-C2_1