The domain within your query sequence starts at position 417 and ends at position 608; the E-value for the C5-epim_C domain shown below is 1.5e-78.
QDEKGGWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDYVFLSSALRATA PYKFPSEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGETLGKEAR SLYERGMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDES PIFKEFVKRWKS
C5-epim_C |
---|
PFAM accession number: | PF06662 |
---|---|
Interpro abstract (IPR010598): | This entry represents the C terminus conserved region of known or predicted D-glucuronyl C5-epimerases. D-glucuronyl C5-epimerase converts D-glucuronic acid residues adjacent to N-sulfate sugar residues to L-iduronic acid residues, both in maturing heparan sulfate (HS) and heparin chains [ (PUBMED:16156897) (PUBMED:25568314) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry C5-epim_C