The domain within your query sequence starts at position 417 and ends at position 608; the E-value for the C5-epim_C domain shown below is 6.1e-81.

QDEKGGWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDYVFLSSALRATA
PYKFPSEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGETLGKEAR
SLYERGMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDES
PIFKEFVKRWKS

C5-epim_C

C5-epim_C
PFAM accession number:PF06662
Interpro abstract (IPR010598):

This entry represents the C terminus conserved region of known or predicted D-glucuronyl C5-epimerases. Glucuronyl C5-epimerases converts D-glucuronic acid residues adjacent to N-sulfate sugar residues to L-iduronic acid residues, both in maturing heparan sulfate (HS) and heparin chains [(PUBMED:16156897), (PUBMED:25568314)].

GO process:glycosaminoglycan biosynthetic process (GO:0006024)
GO component:integral component of membrane (GO:0016021)
GO function:racemase and epimerase activity, acting on carbohydrates and derivatives (GO:0016857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry C5-epim_C