The domain within your query sequence starts at position 200 and ends at position 277; the E-value for the C8 domain shown below is 2.5e-8.

CEDGVQYCDKIIETYFEKCSKVSPLSREYKNVCADEYCRKGGGKQTTCDTYSELARLCAY
DGPGDYEHWRDDSAVVCA

C8

C8
PFAM accession number:PF08742
Interpro abstract (IPR014853):

The proteins in this entry contained a domain rich in positionally conserved cysteine residues. Most proteins contains 7 or 8 cysteine residues. The domain is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin. It is often found on proteins containing IPR001846 and IPR002919.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry C8