The domain within your query sequence starts at position 1 and ends at position 391; the E-value for the CABS1 domain shown below is 6.1e-192.

MAEDGSPKIYSRPPRDNSKTPTEADIFFGADNTIPKSETTITSEGDHVTSVNDCTPDGDF
STTVNKLTPTKEKLKLEDDIEGCLKLTTLPEKEITTPTETPNSKPKGSITENFIPVKIGN
TSSPVGTVSLIDFSSNTAKEDIFLTTIDTGEKEVVPTTEFSGTLEDSAADVEDASGFPDE
STETDVPSSATSDAPDDGAVQVTDSFSPEAGVPPSTEKEVTTIPDITNIAEENVTEIKLI
VSEDRPKTVTKLSDSEEEKFITVFELTNSAEKAKDNVEDPLNDEESTDGANDWMEKETAS
EAESHAVLLTAVESRYDFIVTASETDNVMEESHVNTTDLPENETTESVTNVTEELPSVTS
IVDTLKDKEDLSTTNSGLFKLLKEEPDDLMM

CABS1

CABS1
PFAM accession number:PF15367
Interpro abstract (IPR026118): Calcium-binding and spermatid-specific protein, also known as casein-like phosphoprotein, is involved in spermatogenesis [(PUBMED:19208547), (PUBMED:19271754)].
GO process:spermatogenesis (GO:0007283)
GO function:calcium ion binding (GO:0005509)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CABS1