The domain within your query sequence starts at position 388 and ends at position 561; the E-value for the CAF-1_p60_C domain shown below is 6.3e-69.

GIPLKEKPVLSIRTPDTAKKAKNQTHQGSSPGSRSVEGTPSNRTQDPSSPCTTPSPTTQS
PAPSAIKDSPSAIPAGKSPLPQPSEEKTLQPAGQNMKAPQPRRVTLNTLQTWGKTAPRRI
NLTPLKTDTVPNPQPNSGTAPSTEEVQPEAPGEPPEEPPELKRPRLEEREGDAQ

CAF-1_p60_C

• PFAM accession number: PF15512
• Interpro abstract (IPR029129):

  This entry represents the C-terminal domain of the chromatin assembly factor 1 subunit B (also known as CAF-1 subunit p60), which is one of the three subunits of the CAF-1 complex. This domain binds to the C-terminal region of the CAF-1 subunit A ( IPR022043 ). The N-terminal part of the CAF-1 p60 proteins has a WD-repeat ( IPR001680 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAF-1_p60_C