The domain within your query sequence starts at position 37 and ends at position 301; the E-value for the CAF1 domain shown below is 2.1e-71.

VDVQSDNFKEIWPSLLLALKTASFVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRS
VLSLGLACFRQQPDKGENSYLAQVFNLTLLCIEEYVIEPKSVQFLVQHGFNFNRQYAQGI
PYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPENLGTFTA
DLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAGSPHLALEFCSYPSS
MSGHIDYRCCMSPGTCRRSRTTGIC

CAF1

CAF1
PFAM accession number:PF04857
Interpro abstract (IPR006941):

The major pathways of mRNA turnover in eukaryotes initiate with shortening of the poly(A) tail. CAF1 (also known as CCR4-associated factor 1) is an RNase of the DEDD superfamily, and a subunit of the CCR4-NOT complex that mediates 3' to 5' mRNA deadenylation [(PUBMED:15215893), (PUBMED:15769875)]. In yeast, CAF1 (P39008) is also known as POP2, and encodes a critical component of the major cytoplasmic deadenylase [(PUBMED:11410650), (PUBMED:11239395)]. It is required for normal mRNA deadenylation in vivo and localises to the cytoplasm. CAF1 copurifies with a CCR4-dependent poly(A)-specific exonuclease activity. The crystal structure of Saccharomyces cerevisiae POP2 has been resolved [(PUBMED:14618157)].

Some members of this family contain a single-stranded nucleic acid binding domain, R3H, such as poly(A)-specific ribonuclease (PARN), which also contains and RRM domain [(PUBMED:23388391)]. PARN is only conserved in vertebrates and may be important in regulated deadenylation such as early developmentand DNA damage response [(PUBMED:15247430), (PUBMED:20379136)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAF1