The domain within your query sequence starts at position 537 and ends at position 611; the E-value for the CAF1A domain shown below is 1.1e-25.

KLLQFSENHRPAYWGTWNKKTAIIRPRNPWAQDKDLLDYEVDSDDEWEEEEPGESLSHSE
GDEDDDVGEDEDEDD

CAF1A

CAF1A
PFAM accession number:PF12253
Interpro abstract (IPR022043):

The CAF-1 or chromatin assembly factor-1 consists of three subunits, and this is the first, or A [ (PUBMED:17065558) ]. The A domain is uniquely required for the progression of S phase in mouse cells [ (PUBMED:19172751) ], independent of its ability to promote histone deposition [ (PUBMED:17065558) ] but dependent on its ability to interact with HP1 - heterochromatin protein 1-rich heterochromatin domains next to centromeres that are crucial for chromosome segregation during mitosis. This HP1-CAF-1 interaction module functions as a built-in replication control for heterochromatin, which, like a control barrier, has an impact on S-phase progression in addition to DNA-based checkpoints [ (PUBMED:19172751) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAF1A