The domain within your query sequence starts at position 11 and ends at position 161; the E-value for the CALCOCO1 domain shown below is 2.3e-55.

TSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHSKDWVGIFKVGWSTARDYYTFLWSP
MPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRAASPVEELL
TMEDEGNSDMLVVTTKAGLLELKIEKTLKEK

CALCOCO1

CALCOCO1
PFAM accession number:PF07888
Interpro abstract (IPR012852):

Calcium-binding and coiled-coil domain-containing protein 1 (Calcoco1) from Mus musculus (Q8CGU1) binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1 (Q61026), and thus enhances transcriptional activation by a number of nuclear receptors. Calcoco1 has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region [(PUBMED:14690606)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CALCOCO1